Protein Info for AMB_RS14755 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 11 to 189 (179 residues), 68.1 bits, see alignment E=2.7e-22 PF13185: GAF_2" amino acids 293 to 424 (132 residues), 57.2 bits, see alignment E=7.6e-19 PF01590: GAF" amino acids 295 to 419 (125 residues), 37.9 bits, see alignment E=9.1e-13 TIGR00229: PAS domain S-box protein" amino acids 471 to 531 (61 residues), 55.5 bits, see alignment E=3.2e-19 PF13188: PAS_8" amino acids 475 to 528 (54 residues), 44.8 bits, see alignment 2.7e-15 PF00989: PAS" amino acids 476 to 526 (51 residues), 45.7 bits, see alignment 2.2e-15 PF13426: PAS_9" amino acids 484 to 528 (45 residues), 32.2 bits, see alignment 3.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2931)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W340 at UniProt or InterPro

Protein Sequence (564 amino acids)

>AMB_RS14755 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MKALLNTVERLRLTTKLVIGFSAGILVALVIGLTSLSSLGEIEADMERMYETDLLGISHV
KEANINLIYMGRAMRQMMIAQDDVTRDRARTQVMAARETLRAEMAEARKGFFRPETLAQD
EKFTTNFSRFNENVEHALALIEREKANPSTAARFITSTDFMSVVNMADDDLTALSKIKER
QSKATVEEARRKSDGAKRTAVLFLVLGAMLSAALGVLIGVSITGPNHRLSRSVEELAAGK
VEASIPHADYPNEIGILARSIRVLQDIYRKADEQHWVKSHVAEIGAALQRADDFVTLTQD
AVSRIAPVIGAGHGAFYVADGQGAYSLLASYGYRERKHLSNCFAEGEGLVGQCVVERATI
VLTAPKDYIRIGSGLGEGPPACIMVLPVIHGERVLGVLEVASFQPFTAREQAVLEALMPI
LSASLEILDRNLRTRELLAASQEQAERMEKQAAQLEEQQVEMEAQQAELLETENWFRSII
EAAPDGMMVTDESGRILLVNPAAEALFGYDAGELVGGDIDAVVSPDRRMGLRKDGARFPL
VASSSPLPPRGTRGRCVSLTVRAA