Protein Info for AMB_RS14705 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF12800: Fer4_4" amino acids 9 to 23 (15 residues), 15.9 bits, see alignment (E = 7.5e-06) amino acids 50 to 67 (18 residues), 10.2 bits, see alignment (E = 0.00052) amino acids 85 to 99 (15 residues), 17.8 bits, see alignment (E = 1.9e-06) PF12838: Fer4_7" amino acids 11 to 69 (59 residues), 27.9 bits, see alignment E=1.5e-09 PF13247: Fer4_11" amino acids 47 to 134 (88 residues), 47.2 bits, see alignment E=1.2e-15 PF12798: Fer4_3" amino acids 53 to 69 (17 residues), 14 bits, see alignment (E = 4.3e-05) PF00037: Fer4" amino acids 80 to 101 (22 residues), 21.8 bits, see alignment (E = 6.9e-08) PF13237: Fer4_10" amino acids 80 to 127 (48 residues), 25 bits, see alignment E=8.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2921)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W350 at UniProt or InterPro

Protein Sequence (159 amino acids)

>AMB_RS14705 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MQKSLLIQPAKCTGCRQCEMACSFEKERSFNPSKSRIRVFDIHSEARFVPYTCTQCAQAW
CLQACPVDAIGIDAVTRAKVVNDNICVGCKVCTIACPFGTINYVADSGKVAKCDLCGGDP
ACAKACPTGAITYVDAEQTGYDKMRAWAMKTDTQSHTHA