Protein Info for AMB_RS14565 in Magnetospirillum magneticum AMB-1

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details PF00672: HAMP" amino acids 180 to 232 (53 residues), 40.5 bits, see alignment 4.3e-14 PF00512: HisKA" amino acids 242 to 302 (61 residues), 29.3 bits, see alignment E=1.1e-10 PF02518: HATPase_c" amino acids 349 to 456 (108 residues), 83.4 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2894)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W377 at UniProt or InterPro

Protein Sequence (460 amino acids)

>AMB_RS14565 sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MRPASLLRTTTFRLALSYLGIFTVSAIALLALVSWSTSMFIEWQVQETVEAEATGLSEVY
HSRELGGLAEIIGSRMRQDVEGRNTYLLMGHSGHILAGNIKSWPAEVSSQVGWVRFRLLQ
LGSVGPGVEVLAQVYELADGYRLLVGRSLADAKRVKSAINRALGWGLALTILLGVVGGYF
TSRHLLQRVEEMSRTARRIFGGDMSQRMQLSGTDDEFDSLADSFNEMMDELERLLEGIRT
VSDNIAHDLRTPLNRLRSRIDLVLLGAPDCEGYRRTLEETLADADHLLATFNAILTISHA
EAAARLDRFEVIDPATLAGDVAELYEPLAEEKGLQLHCRADGGLTLKVDRHLLFQALANL
VDNAVKYTPAGGEVSVTVEGGPSSVAVSVADSGPGIPEESREAVLERFVRLDATRSTPGN
GLGLSLVQAVARLHSARLSLEDNQPGLVVRLEFPVTDRQA