Protein Info for AMB_RS14535 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 379 (356 residues), 129.7 bits, see alignment E=6.5e-42 amino acids 278 to 414 (137 residues), 36.9 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2887)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W384 at UniProt or InterPro

Protein Sequence (429 amino acids)

>AMB_RS14535 MFS transporter (Magnetospirillum magneticum AMB-1)
MSETASQPRRPRVHYGWIAAGLTFVTLLVAAGIRSAPGVMMVPVEAEFGWSRATISFAVS
VNLVLYGLMAPFAAAVMDRIGIRRTMALALAVLALGVAATTLMRTPWHMVLLWGIVVGGG
SGTIALVLGATVVTRWFDAYRGTVMGLLSAATATGQLIFLPQMAMLVEHWGWREAVLLIA
AAAAVFAPVIWLFMRDRPADLGLWPVGATSAPPPAIRAGNPAVAAIVALRDGMRSRDFWL
LAGTFFVCGLSTNGLIGTHLISACFDHGIPEVKAAGLLAAMGIFDILGTTASGWLSDRWD
SRKLLFWYYGLRGLSLIFLDLAFGPDVFGLWLFAVFYGLDWIATVPPTVKLTTQAFGRER
AGVMFGWIFAAHQLGAATAAFAAGVIRTDLGDYWLAFVLSGLACLVAAAMSLMIGRKLGP
QPVAEGAAA