Protein Info for AMB_RS14460 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 303 (266 residues), 129.5 bits, see alignment E=6.8e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb2872)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W399 at UniProt or InterPro

Protein Sequence (329 amino acids)

>AMB_RS14460 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MNRLPRRLSLLLLVLLAALALFPAWGPLAFSAKYAFLLQKLTGIMILAILAMSLDLLVGV
AGLVSLGHAAFFGLGGYMLALLSPQYEAANAWVVLPAAMGAVAAVSAVVGFLAIRTAGIY
FIMVTLAFGQMGYYFFNDSKLAGGSDGAYIYVKPNVEAFGITLVNLESKQAFFFVVLGCL
VAVYLWLRVVLASPFGRVLAAIGVNEGRVRGLGFNPMVYKLVAFALAGALAGLAGFLAAT
QYGFVSPAMLGWHQSGHVLVMVILGGMGTLFGPVLGAFILELAHFGLEAVTEHWLLPMGV
LVITIVLALPKGVAGLLLQWCGKKGEGEP