Protein Info for AMB_RS14420 in Magnetospirillum magneticum AMB-1

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 10 to 158 (149 residues), 211.1 bits, E=3.2e-67
• PF01967: MoaC
  • amino acids 21 to 156 (136 residues), 198.3 bits, E=2.6e-63

Best Hits

Swiss-Prot: 75% identical to MOAC_RHORT: Cyclic pyranopterin monophosphate synthase (moaC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to mag:amb2864)

MetaCyc: 59% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See Q2W3A7 at UniProt or InterPro

Protein Sequence (165 amino acids)

>AMB_RS14420 cyclic pyranopterin monophosphate synthase MoaC (Magnetospirillum magneticum AMB-1)
MGAPASGDGLTHFDGDGNAVMVDVSAKAETARVAVARGSVVMAPATLALIAGRGMKKGDV
LSVAQLAGIMGAKRTPELIPLCHPLALSSVGVELSLDPQACAVHIEATCKLVGRTGVEME
ALTAVSVAALTVYDMCKAVDKAMRIENIRLIHKSGGKSGIYEAKE