Protein Info for AMB_RS14390 in Magnetospirillum magneticum AMB-1

Annotation: TIGR00730 family Rossman fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 63 (21 residues), see Phobius details TIGR00730: TIGR00730 family protein" amino acids 2 to 174 (173 residues), 204.1 bits, see alignment E=7.5e-65 PF18306: LDcluster4" amino acids 8 to 115 (108 residues), 62.7 bits, see alignment E=3.1e-21 PF03641: Lysine_decarbox" amino acids 46 to 173 (128 residues), 156.2 bits, see alignment E=5.3e-50

Best Hits

Swiss-Prot: 61% identical to LOGH_PSEAE: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (PA4923) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06966, (no description) (inferred from 100% identity to mag:amb2859)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3B2 at UniProt or InterPro

Protein Sequence (193 amino acids)

>AMB_RS14390 TIGR00730 family Rossman fold protein (Magnetospirillum magneticum AMB-1)
MKRVCVFCGSNSGANPAYAKAAAQLGRLLAERGQVLVYGGGNVGLMGVVADAALAAGGQV
IGVIPESMLKWEVGHPDLTELRVVASMHERKAAMADLADAFIALPGGIGTLEELFEIWTW
GQLGLHAKPLGFLDVAGYFERLHAFLDHMAAEGFVKARHREMVAVHNDPAILLALLDSYR
PPETIRVIDRETA