Protein Info for AMB_RS14330 in Magnetospirillum magneticum AMB-1

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 16 to 347 (332 residues), 459.3 bits, E=3.9e-142
• PF00586: AIRS
  • amino acids 70 to 173 (104 residues), 82.3 bits, E=3.4e-27
• PF02769: AIRS_C
  • amino acids 187 to 353 (167 residues), 140.3 bits, E=5.9e-45

Best Hits

Swiss-Prot: 71% identical to PUR5_BRUA2: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Brucella abortus (strain 2308)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 100% identity to mag:amb2846)

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

See Q2W3C5 at UniProt or InterPro

Protein Sequence (364 amino acids)

>AMB_RS14330 phosphoribosylformylglycinamidine cyclo-ligase (Magnetospirillum magneticum AMB-1)
MPTRKPIPAQDKAPGLTYRDAGVDIDAGEALVEAIKPLAKSTARSGGAAGLGGFGALFDL
KAAGFKDPILVSSTDGVGTKLRVAIEAGKHDTVGIDLVAMCVNDLVVQGAEPLFFLDYFA
TGKLDVKAGTAIVSGIAEGCRQAGCALVGGETAEMPGMYSDGDYDLAGFSVGAAERDALL
PREDVAEGDVLLGLASSGVHSNGYSLVRRIVEKGGLSYEADAPFAPGRKLGEALLEPTRI
YVKSTLAAIKAGTVKAMAHITGGGLIENVPRVLPEGVVAEIDGSAWALPPVFKWLAKEGG
VVAHEMARTFNCGIGMVVVVSASKADEAARILGEHGETVVRIGRIRARKDDEAQSQVLNQ
GDWV