Protein Info for AMB_RS14330 in Magnetospirillum magneticum AMB-1

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 16 to 347 (332 residues), 459.3 bits, see alignment E=3.9e-142 PF00586: AIRS" amino acids 70 to 173 (104 residues), 83.9 bits, see alignment E=1.1e-27 PF02769: AIRS_C" amino acids 187 to 353 (167 residues), 138.2 bits, see alignment E=2.7e-44

Best Hits

Swiss-Prot: 71% identical to PUR5_BRUA2: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Brucella abortus (strain 2308)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 100% identity to mag:amb2846)

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3C5 at UniProt or InterPro

Protein Sequence (364 amino acids)

>AMB_RS14330 phosphoribosylformylglycinamidine cyclo-ligase (Magnetospirillum magneticum AMB-1)
MPTRKPIPAQDKAPGLTYRDAGVDIDAGEALVEAIKPLAKSTARSGGAAGLGGFGALFDL
KAAGFKDPILVSSTDGVGTKLRVAIEAGKHDTVGIDLVAMCVNDLVVQGAEPLFFLDYFA
TGKLDVKAGTAIVSGIAEGCRQAGCALVGGETAEMPGMYSDGDYDLAGFSVGAAERDALL
PREDVAEGDVLLGLASSGVHSNGYSLVRRIVEKGGLSYEADAPFAPGRKLGEALLEPTRI
YVKSTLAAIKAGTVKAMAHITGGGLIENVPRVLPEGVVAEIDGSAWALPPVFKWLAKEGG
VVAHEMARTFNCGIGMVVVVSASKADEAARILGEHGETVVRIGRIRARKDDEAQSQVLNQ
GDWV