Protein Info for AMB_RS14305 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 PF13432: TPR_16" amino acids 10 to 73 (64 residues), 39.8 bits, see alignment E=4e-13 amino acids 46 to 105 (60 residues), 32 bits, see alignment 1.1e-10 amino acids 113 to 173 (61 residues), 22.6 bits, see alignment 9.3e-08 amino acids 180 to 243 (64 residues), 33 bits, see alignment E=5.4e-11 amino acids 215 to 264 (50 residues), 24.5 bits, see alignment 2.3e-08 PF14559: TPR_19" amino acids 15 to 78 (64 residues), 30.8 bits, see alignment E=2.3e-10 amino acids 117 to 177 (61 residues), 30 bits, see alignment 4.1e-10 amino acids 153 to 208 (56 residues), 26.5 bits, see alignment 5e-09 PF13174: TPR_6" amino acids 42 to 71 (30 residues), 18.9 bits, see alignment (E = 1.4e-06) PF13176: TPR_7" amino acids 75 to 109 (35 residues), 14.9 bits, see alignment (E = 1.8e-05) PF13181: TPR_8" amino acids 143 to 173 (31 residues), 14.4 bits, see alignment (E = 2.7e-05) amino acids 175 to 207 (33 residues), 11.8 bits, see alignment (E = 0.00018) PF13414: TPR_11" amino acids 148 to 187 (40 residues), 26.8 bits, see alignment 2.5e-09 PF13844: Glyco_transf_41" amino acids 368 to 514 (147 residues), 46.4 bits, see alignment E=1.4e-15 amino acids 546 to 700 (155 residues), 40.4 bits, see alignment E=9.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2841)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3D0 at UniProt or InterPro

Protein Sequence (728 amino acids)

>AMB_RS14305 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MSADLQFLFRQGIGALQQGKWDEAARQFRTLTGRTPNAPEPFYYLGVALLSGGKPDEAAE
TLTRLIRKHGDNPMALNALGSAQAASGKTGPAEKSFKRVLALAPDLSDAAENLARLLIES
QRAAEALAPLRSVLSREPGRLASRHLLGRALRDTGELEGAMAEFQAVLKAQPDFAPALND
LGLLYFAGGKGEDALACFEHLLALNPADHVAANNRALTLRVLNRPEEAEQQYRAILARHP
QAPEVNLNLGKLLARMGRVMDSVPYLEKGGCIEARWWDALVLPNQYETEDEIIGWRKRFA
DKLGAVTAEILALPPGEVAAQAGILEMDVFFLAYQAENDRELNTLLRSAQTRVAQACFGH
GAPLPARPAGGRIRVGFFSADYFTHVVNRLTAAWATGLDRDEFEVFVFHAGAKWDGETER
LAGLVEHFVDAYAPNAERARMVREADLDILVYPDVGLHPEIDVLAMLRLAPIQCAAFAHP
VTTGMASMDYFISGELIEPEGAEAHYSEKLVRLPGIGFNIIPPKVEEAVLPPARPAGAGP
LFFCAQSLFKMLPRQDNVFPRIAKAVGPCTIDFIDRHGSFTELFRRRMDKAFAAHGLDAG
QYIRIHSQVTSVEFLGMLKAADVSLDSLDWSGGYTTLEALACGTPIAARTGNYLRGHVSA
GILRAAGLDELVAKDEDAYVAVAARLGTDKAYREQVSATMRANAPGVFTNPAPIAGMAAF
LRSAVRGG