Protein Info for AMB_RS14300 in Magnetospirillum magneticum AMB-1

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 11 to 91 (81 residues), 35.5 bits, E=4.1e-13

Best Hits

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 49% identity to azc:AZC_1661)

Predicted SEED Role

"Phosphohistidine phosphatase SixA"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.-

Protein Sequence (188 amino acids)

>AMB_RS14300 histidine phosphatase family protein (Magnetospirillum magneticum AMB-1)
MTEAVTEMRKLFLLRHAKSSWDDPAAEDFDRPLNGRGRKDAKRMGRYMAEQGLRPGMALV
SGAARTRATWEMIEPHLEGVPVAIEAELYEAGKARLLTRLRQLDEHMESVLLIGHNPGIG
RLAEVLADHHGDPALLAALGEKFPTGALAVIDLDIAHWGELEAGRGRLAAFIRPRDFETP
SPAGDSAL