Protein Info for AMB_RS14210 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details PF17200: sCache_2" amino acids 60 to 142 (83 residues), 47.1 bits, see alignment E=5.1e-16 amino acids 165 to 229 (65 residues), 48.6 bits, see alignment E=1.8e-16 PF08269: dCache_2" amino acids 61 to 234 (174 residues), 101.5 bits, see alignment E=1e-32 PF00015: MCPsignal" amino acids 405 to 573 (169 residues), 125.6 bits, see alignment E=3.9e-40 PF13682: CZB" amino acids 619 to 685 (67 residues), 52.2 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to mag:amb2826)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3E5 at UniProt or InterPro

Protein Sequence (731 amino acids)

>AMB_RS14210 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MDAPARIGCALGGYIMGMLDALSGLRITTRLWLLGGLPLMGLATVFIADSVQLKDEMVAA
REVKLRHVVETASGVLEHYAEEARQGRLSEDDAKTAAKAAIKKMRYDKVEYLWMNDMGKP
VPRIVMHPISPQLDGKVLDDAKFNKATSMRTGNSGPFEPLNNVNLFGAFVTVVDKAGQGY
VTYDWPKPKEGGGVTTETYQKLSYVKGFPAWGWLIGSGIYIDDVDTAFRAELARRGVMLA
AILAVVGGLGLLITGSVSLGFRALHHDIDALRSGQSGDAMQLSPTRRDEFRQVAEVLGEM
AEARQRLDAAEQERLAARKKADHDRFVMQRDMLRSLVQAAMLGNEAMITLSRMKREIDMS
TAEVTRMAAAVDDMRGSIDAINADSSHAAQEAGEAGNAAVTGLNASQEALSAFERIVNAV
NAAGQKVQGLAEASAQIGEIVTAIETVAGQTNLLALNATIEAARAGEAGKGFAVVAGEVK
NLANQTAKATVDIRMRIEGLQGEMSSIVGAIDESTGAVTEGRSLVGALGERLHGIADQVG
SVQTSMSTISRELDGQSGTATRLADGTTQVVSLTDANNKLLGDVLEAMGRMSQHLDSQVG
NYASLGSGALLVEIAKNDHIAFKRRVLDGVLGRTDLKADGVPDHHNCRLGKWYDAISDKA
ISSKPAYSNLVNPHQEVHAAAKRALTHAAAGDLDAAFAAIDDMNKASVAVVTMLETLATE
LATLEESRMAG