Protein Info for AMB_RS14200 in Magnetospirillum magneticum AMB-1

Annotation: NAD(P)(+) transhydrogenase (Re/Si-specific) subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 173 to 195 (23 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details TIGR00561: NAD(P)(+) transhydrogenase (AB-specific), alpha subunit" amino acids 5 to 528 (524 residues), 763.1 bits, see alignment E=6.7e-234 PF05222: AlaDh_PNT_N" amino acids 6 to 142 (137 residues), 169.3 bits, see alignment E=8.1e-54 PF01262: AlaDh_PNT_C" amino acids 146 to 372 (227 residues), 230.9 bits, see alignment E=1.7e-72 PF12769: PNTB_4TM" amino acids 437 to 528 (92 residues), 112 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 100% identity to mag:amb2824)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3E7 at UniProt or InterPro

Protein Sequence (528 amino acids)

>AMB_RS14200 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit alpha (Magnetospirillum magneticum AMB-1)
MSLTIGVPRETFPNEKRVASVPDVVEKLIKLGFSVVVETGAGALANFDDESYVAAGATIA
KSAAELWAASGMVFKVRAPSMDEVALIKEGTTLIGFVWPAQNPELMQALAARKITVLAMD
CVPRQLSRAQKMDALSSMANIAGYRAVVEAAHQFGRFFTGQITAAGKVPPAKVFVAGAGV
AGLAAIGTAVGLGAVVRANDTRAEVADQVKSMGAEFVKVEYEEEGSGGGGYAKVMSEGFQ
AAQREMYAQQAREVDIVITTALIPGKPAPRLITAEMVQSMRAGSVIVDMAAEQGGNCELT
VPGEVVVRHGVTIVGYADLPSRLSKQASTLYATNLLRLTEELCKTKDGIIDVNFGDDAIR
GLTVIKDGEITWPAPPLVLPAPPAPKPAAAMPEKKASGHGHGAGEPMSAKSLAITFGIGA
LAFWFVGANAPEAFLGHFTVFVLACFVGYMVVWNVTPALHTPLMSVTNAISSIIVIGALV
QISPPLGEGISRPGFWIGLLAVISIILTSINMFGGFAVTKRMLAMFRK