Protein Info for AMB_RS14195 in Magnetospirillum magneticum AMB-1

Annotation: NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 465 (459 residues), 664.4 bits, see alignment E=5.1e-204

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 100% identity to mag:amb2823)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3E8 at UniProt or InterPro

Protein Sequence (469 amino acids)

>AMB_RS14195 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta (Magnetospirillum magneticum AMB-1)
MSASLATVSYIGATILFILSLGGLSNPETSRRGNVLGMIGMALAVIATVFGPQVTWGGVP
WIIIAMAIGGSVGLYAARTVQMTQMPELVALMHSLVGLAACLVGFASYIDTAHTFVGAEK
TIHDVEIYIGILIGAVTFSGSLIAFGKLSAKIGGKPLLLPARHLLNLAGLLVVIWVGKGF
LNAESTGGGFFALIIMTLIALAFGVHMVMAIGGADMPVVVSMLNSYSGWAAAATGFMLNN
DLLIVTGALVGSSGAILSYIMCRAMNRNFISVIAGGFGTGGGTVAAPADGQPAGEVIPVS
ATETAELLKDAKSVIIVPGYGMAVAQAQHTVYEITKHLREKGVNIRFGIHPVAGRMPGHM
NVLLAEAKVPYDIVMEMDEINDDFPETDVAMVIGANDIVNPAAQEDPNSPIAGMPVLEVW
KAKTSIVMKRSMASGYAGVDNPLFYKENNRMLFGDAKKMLDEVLTALKA