Protein Info for AMB_RS14160 in Magnetospirillum magneticum AMB-1

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 53 to 209 (157 residues), 86 bits, see alignment E=1.1e-28 PF04542: Sigma70_r2" amino acids 57 to 125 (69 residues), 62.5 bits, see alignment E=4e-21 PF08281: Sigma70_r4_2" amino acids 154 to 205 (52 residues), 45.1 bits, see alignment E=9.6e-16 PF04545: Sigma70_r4" amino acids 158 to 206 (49 residues), 30.9 bits, see alignment 2.3e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mag:amb2816)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3F5 at UniProt or InterPro

Protein Sequence (221 amino acids)

>AMB_RS14160 RNA polymerase sigma factor (Magnetospirillum magneticum AMB-1)
MIFRMDRLFRAVQSSDDAWRGGGLDRAGRLRPEMDAASDDDLLRAIAQGDRRSFQRLMER
HVRAMLALSTRVLRNPDDADEIVQEAFLKVWTLASGWQSDREAKFSTWLYRVVLNASLDR
LRRARFVAEEEADEPVDPAPGGLDRVVARQRERLVSTAMAEMPARQREALSLYYFSDLTA
PEAARVLDLSLSAMEALLVRGKRSLRTALARLGIRGIGDVT