Protein Info for AMB_RS14115 in Magnetospirillum magneticum AMB-1

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR02392: alternative sigma factor RpoH" amino acids 14 to 282 (269 residues), 341 bits, see alignment E=5.8e-106 PF00140: Sigma70_r1_2" amino acids 15 to 40 (26 residues), 26.7 bits, see alignment (E = 6.3e-10) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 47 to 279 (233 residues), 97.8 bits, see alignment E=5.1e-32 PF04542: Sigma70_r2" amino acids 52 to 111 (60 residues), 61.3 bits, see alignment E=8.9e-21 PF04545: Sigma70_r4" amino acids 228 to 278 (51 residues), 63.1 bits, see alignment 2.1e-21

Best Hits

Swiss-Prot: 59% identical to RPOH_CAUVC: RNA polymerase sigma factor RpoH (rpoH) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to mag:amb2807)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3G4 at UniProt or InterPro

Protein Sequence (292 amino acids)

>AMB_RS14115 RNA polymerase sigma factor RpoH (Magnetospirillum magneticum AMB-1)
MSVANLPVVAGDDGLAKYLRDIKEFPVLAPEEEFMLAKRWVDYEDTDAAHRLVTSHLRLV
AKIALGYRHYGLPVADLISEGNIGLMRAVKKFEPDRGFRLATYAMWWIKASLNEFVLNSW
SMVKIGTLAAQKKLFFNLRRIKSRLRLLEAGDLAPEHVATIARELDVDERDVVAMNRRMA
GRDSSLNAPVGEGGTEIQDLMADEADNQETAYGKREELSKGRVLIARALDSLTEREREVF
VERRLRDDPVTLEELGGRYGVSRERIRQIEVKAFEKVRDLVQAGFLPAPARA