Protein Info for AMB_RS14105 in Magnetospirillum magneticum AMB-1

Annotation: citrate (Si)-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01798: citrate (Si)-synthase
  • amino acids 21 to 431 (411 residues), 766.4 bits, E=3.1e-235
• PF00285: Citrate_synt
  • amino acids 54 to 420 (367 residues), 471.6 bits, E=8.4e-146

Best Hits

Swiss-Prot: 74% identical to CISY_RHIME: Citrate synthase (gltA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to mag:amb2804)

MetaCyc: 68% identical to citrate synthase monomer (Acetobacter aceti)
Citrate (Si)-synthase. [EC: 2.3.3.1, 2.3.3.16, 2.3.3.3]

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle VII (acetate-producers) (8/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• methylaspartate cycle (14/19 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glyoxylate cycle (4/6 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (9/14 steps found)
• mixed acid fermentation (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.1 or 2.3.3.16 or 2.3.3.3

Sequence Analysis Tools

See Q2W3G7 at UniProt or InterPro

Protein Sequence (438 amino acids)

>AMB_RS14105 citrate (Si)-synthase (Magnetospirillum magneticum AMB-1)
MTNENKTPKESVTLINNSTGKSTEFPLLSGSIGPKVADIRSLYASQDIFTYDPGYMSTGS
CKSAITYIDGDAGVLLHRGYAISDLAENCSFLEVAYAILKGELPNAEQKTKFESDITRHS
MLNEQISFFFRGFRRDSHPMAVMCGVVGAMAAFYHDSVDINDPHQRMIASYRLVAKMPTI
VAWAYKYSQGQPFMYPQNKLSYAENFLHMMFATPCEEYKVSPVLARAMDRILILHADHEQ
NASTSTVRLAGSSGANPFACIAAGIASLWGPAHGGANEAVLEMLHEIGSVDRIPEYIKKA
KDKDDPFRLMGFGHRVYKNYDPRAKIMAKTCHEVLNELGNHDEPLLKLAMELERIALEDP
YFVERKLFPNVDFYSGIIFRAMGIPTQVFTCLFALARTVGWIAQWNEMLTDPDQKIGRPR
QLYVGPAQRDFVPLAKRG