Protein Info for AMB_RS14100 in Magnetospirillum magneticum AMB-1

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR00464: glutamate--tRNA ligase" amino acids 3 to 464 (462 residues), 501.2 bits, see alignment E=1.6e-154 PF00749: tRNA-synt_1c" amino acids 3 to 305 (303 residues), 304.3 bits, see alignment E=8e-95 PF19269: Anticodon_2" amino acids 337 to 466 (130 residues), 110.2 bits, see alignment E=1.2e-35

Best Hits

Swiss-Prot: 100% identical to SYE2_MAGSA: Glutamate--tRNA ligase 2 (gltX2) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 100% identity to mag:amb2803)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3G8 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AMB_RS14100 glutamate--tRNA ligase (Magnetospirillum magneticum AMB-1)
MTVVTRFAPSPTGFLHIGGGRTALFNWLFARHHGGKFLLRIEDTDRARSTDAAVEAIFDG
IKWLGLDWDGEAVMQFARACRHAEVARQLLDEGKAYRCYCTQDELTAIREEQKAKGQPMR
YPGIWRDRPATDAPEGAPFVVRLKAPAEGETIIADLVQGDVRVANDQLDDMVLLRADGTP
TYMLSVVVDDHDMGITHVIRGDDHLTNAFRQYQLYKACGWEVPTFAHIPLIHGPDGAKLS
KRHGALGVDAYRDMGFLPEAMRNYLLRLGWSHGDDEIISTEQAVEWFTLDSVGRSPSRFD
FVKLTNLNGHYMRGADDGRLTEVLVPLLEAKTGKALSGESVARLRTGMTGLKERAKTMVE
LADSALFYVAERPLALDEKAAKTMADETATADLAAYRTEVKELGAWTRDTLEDAARRLAE
ARGQKLGKIAQPLRAALAGSSVSPPIFEVMEVLGREESLGRIEDALGGTRPTTSTAA