Protein Info for AMB_RS14040 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 10 to 407 (398 residues), 664 bits, see alignment E=4.6e-204 PF06689: zf-C4_ClpX" amino acids 14 to 50 (37 residues), 70.8 bits, see alignment 3.1e-23 PF07724: AAA_2" amino acids 111 to 307 (197 residues), 122.7 bits, see alignment E=7.6e-39 PF07728: AAA_5" amino acids 113 to 190 (78 residues), 26.1 bits, see alignment E=3.4e-09 PF00004: AAA" amino acids 114 to 231 (118 residues), 61.3 bits, see alignment E=6.1e-20 PF10431: ClpB_D2-small" amino acids 314 to 384 (71 residues), 43.3 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 100% identical to CLPX_MAGSA: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to mag:amb2791)

MetaCyc: 71% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3I0 at UniProt or InterPro

Protein Sequence (421 amino acids)

>AMB_RS14040 ATP-dependent Clp protease ATP-binding subunit ClpX (Magnetospirillum magneticum AMB-1)
MTKSTSGDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKTHLVRSR
DGVPTPKDICQVLDDYVIGQSHAKKVLSVAVHNHYKRLQHGGKNNEVELAKSNILLIGPT
GCGKTLLAQTLARILDVPFTMADATTLTEAGYVGEDVENIILKLLQAAEYNVERAQRGIV
YIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTT
NILFICGGAFAGLEKIIGSRGRGTSIGFGADVRGPDERRTGEILREVEPEDLLKFGLIPE
FVGRLPVLATLEDLDVDALIDILSKPKNALVKQYQRLFEMEDTRLAFSDDALKAIAEKAI
ARKTGARGLRSIMETILLDTMFDLPGLDAVDEVVINKEVVEGRAKPLYIYAERREDVGSS
A