Protein Info for AMB_RS13910 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 110.6 bits, E=1e-35

Best Hits

Swiss-Prot: 52% identical to LOLD1_CHLCH: Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1) from Chlorobium chlorochromatii (strain CaD3)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to mag:amb2766)

MetaCyc: 46% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein YvcR"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See Q2W3K5 at UniProt or InterPro

Protein Sequence (224 amino acids)

>AMB_RS13910 ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MEVAIEARGVTRDLPGPVPVTLVRDIDLTVGRGEFVAVTGPSGSGKSSLLYLLGLLDVPT
GGSVWLQGGNTAGLPPDAMAELRLASIGFVFQFHFLLPEFTCQSNVEIPIRRLGALSDSQ
ARIRAAELLDSLELADHRRKYPDQLSGGQRQRVAIARALANDPPLILADEPTGNLDTRTA
HLVFELFRDLAHRQNRTVIVVTHDAELAQTADRRVHLVDGRIVG