Protein Info for AMB_RS13905 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details amino acids 328 to 352 (25 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 255 (236 residues), 55 bits, see alignment E=1.3e-18 PF02687: FtsX" amino acids 287 to 407 (121 residues), 83.9 bits, see alignment E=9.2e-28

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to mag:amb2765)

Predicted SEED Role

"FIG00780612: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3K6 at UniProt or InterPro

Protein Sequence (415 amino acids)

>AMB_RS13905 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MLPLGLSIALQHLRHRRRQTLVSLLGVSLGVAFFIGISAMMQGFQRDFIARIIDVQPHII
VKDEVRAAPKQAVERAYPDGAVSLRGLKPREEVRGIRGARNMLATLEEMPGVHVAPALSG
NLLLRFGGKDVSVNVTGIQPERERLVTHLEKDLLSGSLDALYTTSNAIIIGEGIAAKAGI
RKDDLISAVSPVGVVLKMKVVGIFRSNITLLDNFETYTLLKKAQVLQNRANVVNRLNLRL
DDVEQAAPLAATIERQFGYRSESWQEQSRNVLGIFVIQNAIMYSTVSAILIVACFGIFNV
ISTVVFEKTRDIGILKSMGFRDKDIRRIFVMEGLIVGLIGTVIGWLMGWGLIEFMASLDF
QMEGFVKAQGFVLYRTPKHYAISAAMAIASATLAAWVPARRASRLNPVDIVRGAG