Protein Info for AMB_RS13890 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent dethiobiotin synthetase BioD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to BIOD_MAGSA: ATP-dependent dethiobiotin synthetase BioD (bioD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: None (inferred from 100% identity to mag:amb2762)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

biotin biosynthesis I (13/15 steps found)
biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
biotin biosynthesis II (4/6 steps found)
biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3K9 at UniProt or InterPro

Protein Sequence (205 amino acids)

>AMB_RS13890 ATP-dependent dethiobiotin synthetase BioD (Magnetospirillum magneticum AMB-1)
MRGVFVTGTDTDVGKTMVSAWLAQHWRADYWKPIQTGSTEGTDFESVARLAPAARIHPSA
VVLPAPLSPHEAARREKTRIDLSSLVPPVTDRPLVVEGAGGIMVPINEVALMIDLMERLS
LPAVVVARSGLGTINHTLMTLEMLRRRRVPLLGVVMNGQKNPANRQAIEHFGGVRVLAEI
QPLPAVTAATIAGLPPPTFTCPGDP