Protein Info for AMB_RS13885 in Magnetospirillum magneticum AMB-1

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01209: Ubie_methyltran" amino acids 26 to 141 (116 residues), 20.3 bits, see alignment E=9.5e-08 PF13489: Methyltransf_23" amino acids 29 to 153 (125 residues), 57.7 bits, see alignment E=3.8e-19 PF13847: Methyltransf_31" amino acids 44 to 142 (99 residues), 36.8 bits, see alignment E=9.7e-13 PF08241: Methyltransf_11" amino acids 46 to 138 (93 residues), 55.3 bits, see alignment E=2.6e-18 PF13649: Methyltransf_25" amino acids 46 to 135 (90 residues), 56 bits, see alignment E=1.7e-18 PF08242: Methyltransf_12" amino acids 46 to 137 (92 residues), 55.8 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2761)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3L0 at UniProt or InterPro

Protein Sequence (244 amino acids)

>AMB_RS13885 methyltransferase domain-containing protein (Magnetospirillum magneticum AMB-1)
MSRKQTITKAFSAAAGTYESAARAQVWAADSLVERLGPIPTPIRALELGCGTGLLTRRLA
AALPAGSRILATDLSPAMVQAASAALPALSFAVMDAEAPGVAGPFDLIASSLAAQWFTDL
PATLGRLAGLLAPGGRLLLTTLGAGTFVQWKDAHRTLGLDSGIPDYPEAADLAAMLPGAR
VERLPLTLSYKDARNFLLCLEALGAQTPKPGHRPLSPGQVRRIITSLGSPCAMTWDILLL
DYRP