Protein Info for AMB_RS13865 in Magnetospirillum magneticum AMB-1

Annotation: biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00433: biotin synthase" amino acids 28 to 324 (297 residues), 402.2 bits, see alignment E=6.8e-125 PF04055: Radical_SAM" amino acids 62 to 221 (160 residues), 81.6 bits, see alignment E=7.6e-27 PF06968: BATS" amino acids 233 to 324 (92 residues), 90.8 bits, see alignment E=5.1e-30

Best Hits

Swiss-Prot: 100% identical to BIOB_MAGSA: Biotin synthase (bioB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to mag:amb2757)

MetaCyc: 63% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3L4 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AMB_RS13865 biotin synthase (Magnetospirillum magneticum AMB-1)
MTAQAALATAANDGELRHDWSAEEIEALFALPFNDLMFEAQKVHRAHFDANRVQVSRLIS
IKTGSCPEDCSYCPQSAHYATGLEKEKLLAVEEVVESARQAKEEGASRFCMGAAWRGPKG
DDFEVAVAMIEGVKALGMETCATFGLLDKWQAQRLKEAGLDYYNHNIDTSPEHYSEVITT
RTFQDRLDTLDVVRDAGLHVCSGGIVGLGETRTDRARMIQTLANMPKHPDSVPINLLIPI
QGTPLADAERPDSFDFIRTIAVARITMPKSFVRLSAGREGMTEEMQALCFLAGANSVFCG
QKLLTAKNAAPGKDKSLFGKLGLQPM