Protein Info for AMB_RS13845 in Magnetospirillum magneticum AMB-1

Annotation: phenylacetic acid degradation protein PaaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 30 to 139 (110 residues), 71.6 bits, E=5.7e-24
• TIGR02286: phenylacetic acid degradation protein PaaD
  • amino acids 30 to 140 (111 residues), 134.6 bits, E=1.7e-43
• PF03061: 4HBT
  • amino acids 59 to 132 (74 residues), 54.6 bits, E=5.8e-19

Best Hits

Swiss-Prot: 43% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 100% identity to mag:amb2753)

MetaCyc: 43% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein paaI"

Sequence Analysis Tools

See Q2W3L8 at UniProt or InterPro

Protein Sequence (151 amino acids)

>AMB_RS13845 phenylacetic acid degradation protein PaaD (Magnetospirillum magneticum AMB-1)
MPQRASDETQRQALAERVGAAIGERDTASRLLGTVLDAIRPGYARMSLTVSDQMLNGVGI
GHGGITYTLADTAFAYACNSYNRPAVALSCTITYPAAARLGDRLTAECREVHRKGRNGTY
DCTVTNQSGEVVALFRGQCRILEGHIVEGSP