Protein Info for AMB_RS13840 in Magnetospirillum magneticum AMB-1

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 245 to 402 (158 residues), 139.8 bits, see alignment E=3.6e-45 PF00990: GGDEF" amino acids 248 to 401 (154 residues), 128.6 bits, see alignment E=9.6e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2752)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3L9 at UniProt or InterPro

Protein Sequence (419 amino acids)

>AMB_RS13840 sensor domain-containing diguanylate cyclase (Magnetospirillum magneticum AMB-1)
MQRFQSRITVSQGPWKGIRKQRVLVLKAVIKKVLAVVFSGMTMSEIFDLFLPTRQSAFVQ
RRRSLLILSRVRLVALTFAVLTPLWIPVDLVIFETTLAMYLAALRVMASIAFVLLALSFR
GSDSVAVARWGLVWLLTIPTVFFLISHPLLAQFAINDPAQQVIAAGYAFLPFVMVAGLSV
FPITALEGALLGLPLVVAYFLTGVLGYQLLPFASHLGAQWLLLLLAMVATLSGMSQLHFM
SQLVDQSSHDGLTRAYNRRVGEEMLVQQFVTAARSKIPLSLAFVDLDNFKSINDKYGHEE
GDNALRIASASLRKVLRRGDILIRWGGEEFIAVMPNTDPAGAAIAIARLRSAGLGIRPDG
RPLTASIGVAERLTDGIESWNELVERADHRMYAAKQSGKDRVIGCGDLVLGETVSQALA