Protein Info for AMB_RS13750 in Magnetospirillum magneticum AMB-1

Annotation: glucosamine-6-phosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01182: Glucosamine_iso
  • amino acids 12 to 223 (212 residues), 81.5 bits, E=4.4e-27

Best Hits

Swiss-Prot: 51% identical to NAGB_PSECP: Glucosamine-6-phosphate deaminase (nagB) from Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 100% identity to mag:amb2734)

MetaCyc: 43% identical to glucosamine 6-phosphate isomerase 1 (Giardia intestinalis)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation I (1/2 steps found)
• N-acetylglucosamine degradation II (1/3 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (1/6 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• chitin degradation I (archaea) (1/7 steps found)
• chitin derivatives degradation (1/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See Q2W3N7 at UniProt or InterPro

Protein Sequence (261 amino acids)

>AMB_RS13750 glucosamine-6-phosphate deaminase (Magnetospirillum magneticum AMB-1)
MRVLIEPNGPSVAERAASLVGALALSKPDCVIGLAAGATPLAMYARLTDPARSLDFSRAT
IFGLDEYLGLGEEHPASCALTLRQHFIDKAGIPPSRVHLLDGRAAEDLPAYCAAYEERIA
AAGGLDLQILGLGVNGHIGFNEPGSGLACRTRLVGLRRSTRRTNAPIFAPAEVPKAALTT
GIGTILAARRILLLATGPAKAEAVAKMIEGPVSAVIPASALQLHPDAVVILDEAAAAGLA
LAEDYRDEAEILLQRGGIAAL