Protein Info for AMB_RS13620 in Magnetospirillum magneticum AMB-1

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 444 (444 residues), 732.9 bits, see alignment E=6.7e-225 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 159.1 bits, see alignment E=1.5e-50 PF02786: CPSase_L_D2" amino acids 115 to 321 (207 residues), 274.5 bits, see alignment E=1.7e-85 PF02222: ATP-grasp" amino acids 124 to 291 (168 residues), 36.7 bits, see alignment E=1e-12 PF07478: Dala_Dala_lig_C" amino acids 125 to 290 (166 residues), 37 bits, see alignment E=8.1e-13 PF02785: Biotin_carb_C" amino acids 335 to 440 (106 residues), 132 bits, see alignment E=2.8e-42

Best Hits

Swiss-Prot: 62% identical to ACCC_HAEIN: Biotin carboxylase (accC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 100% identity to mag:amb2708)

MetaCyc: 60% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14, 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3R3 at UniProt or InterPro

Protein Sequence (447 amino acids)

>AMB_RS13620 acetyl-CoA carboxylase biotin carboxylase subunit (Magnetospirillum magneticum AMB-1)
MFEKVLIANRGEIALRIHRACREMGIRTVAVHSTADNDAMHVRLADEAVCIGPPSARDSY
LNKAAILSAASITGADAIHPGYGFLSENADFAQMVEEHGFVFIGPTPDHIRMMGDKITAK
QAVKDAGIPVVPGSDGSVDTEETALEVAASIGYPVLIKATAGGGGKGMKVARNAEELVES
WKLARNEAKAAFGNADVYMEKYLGKPRHIEMQILADNYGAVVHLGERDCSLQRKHQKVLE
EAPSPALNADQRARIGKIACDAIAKLGYRNAGTIEFLYENGEFYFIEMNTRLQVEHPITE
AITGIDLVREQIRIAAGAPLGYTQADVRFAGHALECRVNAEDPVTFTPCPGRIEGYHAPG
GLGVRVDSGLYAGYRIPPHYDSMIAKLIVFGNTRNEALMRLKRALGEYVIEGVKTTLPLH
NRLVQDADFVNGDYDIHWLEKFVAQHS