Protein Info for AMB_RS13590 in Magnetospirillum magneticum AMB-1

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR01683: thiamine biosynthesis protein ThiS" amino acids 4 to 66 (63 residues), 72.5 bits, see alignment E=1.4e-24 PF02597: ThiS" amino acids 5 to 66 (62 residues), 47.2 bits, see alignment E=2.8e-16 PF05690: ThiG" amino acids 75 to 319 (245 residues), 367.8 bits, see alignment E=2.5e-114

Best Hits

Swiss-Prot: 100% identical to THIG_MAGSA: Thiazole synthase (thiG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to mag:amb2702)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3R9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>AMB_RS13590 thiazole synthase (Magnetospirillum magneticum AMB-1)
MKLVINGEERNFSASMTVEALLGELGVDSRKVAVERNLEIVPKSSYAQVAVNDGDKLEIV
AFIGGGSDQADSFTVAGKTFNSRLLVGTGKYKDFEETALAIEASGAEIVTVAVRRVNLSD
PSKPMLVDYVSPKKYTFLPNTAGCYTADDSVRTLRLAREAGGWNLVKLEVLGDQTTLYPN
MPETLKAAEALIKDGFEVMVYCSDDPIQAKMLEDMGCVAIMPLGSLIGSGLGILNPTTIR
IIKDTVKVPVLVDAGVGTASDAALAMELGCDGVLMNTAIAHAKDPIRMARAMKLAIEAGR
LSYLAGRMPKKSYADPSSPTSGLI