Protein Info for AMB_RS13585 in Magnetospirillum magneticum AMB-1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 5 to 223 (219 residues), 56.6 bits, see alignment E=1.2e-18 PF00975: Thioesterase" amino acids 46 to 228 (183 residues), 33.8 bits, see alignment E=8.3e-12 PF00561: Abhydrolase_1" amino acids 55 to 217 (163 residues), 46.9 bits, see alignment E=5.7e-16 PF12146: Hydrolase_4" amino acids 56 to 211 (156 residues), 35.4 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2701)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3S0 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AMB_RS13585 alpha/beta hydrolase (Magnetospirillum magneticum AMB-1)
MSRGLVLLPGLLNDHRLWLRQAAALGGEVEVLVADLTLDESLGAMAERVLGAAPERFALA
GLSMGGYVALEIMRRAPGRVERLALLDTTARPDLPEQTQRRRDAVELARSGGFDKIMPTM
LPLLLHPDHLADAAITALAKDMARAVGAQAFARQQAAIMARPDSRDSLAAIACPTLVLCG
AEDTLTPPDRHDEMAALIKGARRATIAHCGHLSPLEQPDAVSAELRAWLSV