Protein Info for AMB_RS13560 in Magnetospirillum magneticum AMB-1

Annotation: ribulose-bisphosphate carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to RBL2_MAGSA: Ribulose bisphosphate carboxylase (cbbM) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 100% identity to mag:amb2696)

MetaCyc: 76% identical to ribulose bisphosphate carboxylase subunit (Rhodospirillum rubrum)
Ribulose-bisphosphate carboxylase. [EC: 4.1.1.39]

Predicted SEED Role

"Ribulose bisphosphate carboxylase (EC 4.1.1.39)" in subsystem AMP to 3-phosphoglycerate or CO2 uptake, carboxysome or Calvin-Benson cycle or Photorespiration (oxidative C2 cycle) (EC 4.1.1.39)

MetaCyc Pathways

Rubisco shunt (10/10 steps found)
Calvin-Benson-Bassham cycle (12/13 steps found)
1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
ethene biosynthesis V (engineered) (18/25 steps found)
oxygenic photosynthesis (12/17 steps found)
nucleoside and nucleotide degradation (archaea) (1/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3S5 at UniProt or InterPro

Protein Sequence (459 amino acids)

>AMB_RS13560 ribulose-bisphosphate carboxylase (Magnetospirillum magneticum AMB-1)
MDQSKRYVNLGLREADLIKGGRHVLCAYRMRPRPGHGYVETAAHFAAESSTGTNVEVCTT
DDFTRGVDALVYEVDEAEGLMKIAYPVELFDRNIIDGKAMIASFLTLTVGNNQGMSDVEN
AKMEDFYVPPDFLTLFDGPARNIAHMWKVLGRPEVNGGMVVGTIIKPKLGLRPKPFADAC
HQFWLGGDFIKNDEPQGNQVFAPFKDTMRLVADSMRRAQDETGQAKLFSANITADDPAEM
IARGQFILDTFGENASHVAFLVDGFVAGPTAVTTCRRNFPDTFLHYHRAGHGAITSRQSK
RGYSVLVHMKMARLLGASGIHTGTMGYGKMEGAPDEKVVAYMLERPTAEGPHYRQDWGDM
RACTPIISGGMNALRLPGFFDNLGHSNVIQTSGGGAFGHKDGPVAGALSLRQAHEAWMRG
ISLVEYAQGHPELRGAFESFASDADRLYPGWRDRLRIAA