Protein Info for AMB_RS13480 in Magnetospirillum magneticum AMB-1

Annotation: NAD(P)H quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 6 to 330 (325 residues), 485.5 bits, see alignment E=3.2e-150 PF08240: ADH_N" amino acids 32 to 114 (83 residues), 57.4 bits, see alignment E=2.3e-19 PF00107: ADH_zinc_N" amino acids 156 to 277 (122 residues), 107.5 bits, see alignment E=7.4e-35 PF13602: ADH_zinc_N_2" amino acids 188 to 328 (141 residues), 101.1 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 34% identical to QOR_RAT: Quinone oxidoreductase (Cryz) from Rattus norvegicus

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to mag:amb2679)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3U2 at UniProt or InterPro

Protein Sequence (330 amino acids)

>AMB_RS13480 NAD(P)H quinone oxidoreductase (Magnetospirillum magneticum AMB-1)
MLPETMTCVEISTPGAPEVLKPVTRPLPSPKAGEVLIKVAAAGINRPDVLQRAGAYPAPP
GASDLPGLEVAGTIAALGEGAASPALGSRVCALAPGGGYAEYCTVDARHCLPIPAGYDMI
RAAALPETFFTVWHNVVERGQLKAGERFLVHGGAGGIGTTAIQLAKALGATVFATANGEA
KGKACRDLGADFAIDYSTADFVEVIKAETKGKGVDVILDMVGGDYIARNIKSLAADGRLV
SIAFLRGSSAEINLMPVMLKRLTLTGSTLRPQSNDAKARMARGLAETVWPLLDKGAIAPL
IHAVFPLAEAAKAHALMESNAHMGKIVLQV