Protein Info for AMB_RS13455 in Magnetospirillum magneticum AMB-1

Annotation: formate dehydrogenase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 82 to 103 (22 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 118 to 319 (202 residues), 142.9 bits, see alignment E=6.7e-46 PF01292: Ni_hydr_CYTB" amino acids 120 to 291 (172 residues), 77.3 bits, see alignment E=6.5e-26

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 100% identity to mag:amb2674)

Predicted SEED Role

"Formate dehydrogenase -O, gamma subunit (EC 1.2.1.2)" in subsystem Anaerobic respiratory reductases or Formate hydrogenase (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3U7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AMB_RS13455 formate dehydrogenase subunit gamma (Magnetospirillum magneticum AMB-1)
MSRTILAILVLVFGLGLAQPVRAAGSDGDIPTAAQSDRITSPDSWRSIRQGEAGYIGGQP
AARGVLIQSEGETWRNFRNGKLAVYAGWLLIGVTLAIAAFYFIRGKIMMEGGPSGQTILR
FTKIERIGHWLTAGSFLVLAATGLNILFGRWIIEPWLGKTLFSWLTWAGKWLHNISGFVF
MAGLVVIFYLWARDNLWDRYDWGWIKGGGGLLKKGVHPPAAKFNFGQKTQFWMVIVVGAL
VSSTGLNLLWPFTLGDIHAMQVMQLVHAALAVVMVLFILGHIYIGTIGMEGASTAVTTGY
VDREWAREHHAVWVEEVEKSEPKAAE