Protein Info for AMB_RS13420 in Magnetospirillum magneticum AMB-1

Annotation: molybdenum cofactor guanylyltransferase MobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 9 to 198 (190 residues), 204.1 bits, see alignment E=1e-64 PF12804: NTP_transf_3" amino acids 11 to 170 (160 residues), 131.6 bits, see alignment E=3.1e-42 PF11749: DUF3305" amino acids 221 to 361 (141 residues), 150.7 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 100% identity to mag:amb2667)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3V4 at UniProt or InterPro

Protein Sequence (382 amino acids)

>AMB_RS13420 molybdenum cofactor guanylyltransferase MobA (Magnetospirillum magneticum AMB-1)
MVPPASNAIAGLILAGGLSRRMGGGDKPLISVGGQSLLERVIDRLRPQVGPMVLNANGDP
VRFADTTLPVVPDVLDGYGGPLVGVLTGLEWLRDHTFDVEWMVSVAADTPLFPDDLVDRL
HKAAVEQNADIVVARSGEQAHPVFALWPLRLAAELRRAVVDEGMRKIDAWTERYRVAHVD
WPTRPHDPFFNVNTPEDVMRLGMILDGTLPAEPPLSAETGIAVLVERRDGATQWIKDSWR
PLEALVDAPEGGPWTLLRRDTGFEHYLAGGVKVVLHRSDITSYRYNLAGLEPRLYVVLRH
TGEADMPVKVVMATIAPDEAQAMSESGEDMVDGVPLPRALFDWAMAFCACHPPDEPMRKR
KRDKLDSDKVFGAKGRNASPGD