Protein Info for AMB_RS13340 in Magnetospirillum magneticum AMB-1

Annotation: glycine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 10 to 289 (280 residues), 488.5 bits, see alignment E=3.3e-151 PF02091: tRNA-synt_2e" amino acids 11 to 288 (278 residues), 499 bits, see alignment E=1.7e-154

Best Hits

Swiss-Prot: 82% identical to SYGA_RHORT: Glycine--tRNA ligase alpha subunit (glyQ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 100% identity to mag:amb2651)

MetaCyc: 68% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3X0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>AMB_RS13340 glycine--tRNA ligase subunit alpha (Magnetospirillum magneticum AMB-1)
MGIVGTKKPSFQSLILTLQAFWAEQGCVILQPYDMEVGAGTFHPATTLRALGPDHWKCAY
VQPSRRPKDGRYGENPNRLQHYYQYQVLLKPSPPNAQELYLESLRRLGVDPLAHDIRFVE
DDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIECDPVAVELTYGLERLAMYIQGVE
NVYDLDFNGDGVTYGDVFLQAEKEYSAHNFEHADTDMLLQHFLDAEKECKNLLEKGVALP
AYDQCIKASHRFNLLDARGVISVTERQAYIGRVRALAKACCEGWLASRTTGKEG