Protein Info for AMB_RS13305 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 286 to 305 (20 residues), see Phobius details PF00672: HAMP" amino acids 304 to 353 (50 residues), 26.8 bits, see alignment 2.2e-09 TIGR00229: PAS domain S-box protein" amino acids 362 to 484 (123 residues), 48.7 bits, see alignment E=4.1e-17 amino acids 490 to 558 (69 residues), 33.9 bits, see alignment E=1.5e-12 amino acids 569 to 628 (60 residues), 26.1 bits, see alignment 4e-10 PF13188: PAS_8" amino acids 368 to 414 (47 residues), 18.7 bits, see alignment 5.4e-07 PF13426: PAS_9" amino acids 385 to 477 (93 residues), 24.9 bits, see alignment E=8.3e-09 amino acids 503 to 619 (117 residues), 53.9 bits, see alignment E=7.9e-18 PF08448: PAS_4" amino acids 386 to 480 (95 residues), 31.3 bits, see alignment E=8.4e-11 amino acids 504 to 621 (118 residues), 29.5 bits, see alignment E=3.1e-10 PF00989: PAS" amino acids 491 to 618 (128 residues), 53.7 bits, see alignment E=7.9e-18 PF00512: HisKA" amino acids 635 to 700 (66 residues), 41 bits, see alignment 6.4e-14 PF02518: HATPase_c" amino acids 744 to 854 (111 residues), 95.7 bits, see alignment E=9.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2644)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3X7 at UniProt or InterPro

Protein Sequence (863 amino acids)

>AMB_RS13305 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MDFRSLRIRILSLFLLSFLGAGAVVALALAGSLQRDVETLLARQQVTFVSGLAEELDQKI
KLQIEAMERVAPLVLRVDRGDGGALKAFIEDRTGIKGFFAGGLLVLGADGRVLAETPNLG
RLGKGMADEIGVGSVLASGRSLVSEPYFDHALNQPAVAMAVPIRRGEAVVGALVGIATLT
QSNLLGRLVEQKVGESGGLYMVSPKSGLIVVSTNKERIFTPVPRRGQNHMLDRYMDGFEG
SGVTVSSAGLEELTSARRIASTGWVLVARLPTAEAFEPVADIKTRLFAALAGLGLTSLGL
LWLVLRSALSPLHRATGRIQAMVDGNAPFEAVEISRGDEVGRMIGAFNALQAKVAAADVA
LREREGLYHALFRGCKAVELLIDPAEDGRIIDANRAAEAYYGWSHDQLLSMRISEINILD
RAAIIAEMHKAELEERDHFDFRHRLASGEVRDVEVWSGPVQVTGRQLLYSIVHDVTARRA
AEREVRSLLAFRRAVLDGAGSSIVATAVDGTILLFNPTAERWLGYGAEEVVGRMTPAAFH
DSEEVSQRVARLSQELGREVEPGFECFIAKVLDSGKPDSGEWTYVRKDGSRFRVLLTVTA
LYDEEGVLSGFLGVAQDISARLSIEKELKRSNAELENFAYVASHDLRQPLRMISSYIALL
QRRLGDALDQDCQDFIGFAVGGAQRMDHMITDLLQYSRLGRSGTPPAAVNLAEVVKLAQA
NLGALIEETGAAVTVAEGLPTVRGNEVELERLFQNLISNAVKFQAQGRLPLVEITWRATA
DEWIISVRDNGIGIDEAGRQKLFQIFQRLVRLDQYPGSGIGLASCRKIAEHHGGRIWVES
QPGEGSTFQVALPVSGPDESHAG