Protein Info for AMB_RS13225 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 925 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 341 to 360 (20 residues), see Phobius details PF08269: dCache_2" amino acids 56 to 330 (275 residues), 187.4 bits, see alignment E=1.5e-58 PF17200: sCache_2" amino acids 73 to 217 (145 residues), 99.7 bits, see alignment E=6.9e-32 amino acids 220 to 331 (112 residues), 66.2 bits, see alignment E=1.5e-21 PF17201: Cache_3-Cache_2" amino acids 220 to 332 (113 residues), 51.4 bits, see alignment E=4.5e-17 PF00672: HAMP" amino acids 362 to 409 (48 residues), 47.1 bits, see alignment 1.1e-15 TIGR00229: PAS domain S-box protein" amino acids 427 to 551 (125 residues), 37.4 bits, see alignment E=1.2e-13 PF00989: PAS" amino acids 432 to 540 (109 residues), 22.9 bits, see alignment E=3.3e-08 PF08448: PAS_4" amino acids 437 to 545 (109 residues), 53.7 bits, see alignment E=1.1e-17 PF00512: HisKA" amino acids 561 to 623 (63 residues), 28.5 bits, see alignment 5.9e-10 PF02518: HATPase_c" amino acids 667 to 784 (118 residues), 66.4 bits, see alignment E=1.4e-21 PF00072: Response_reg" amino acids 810 to 915 (106 residues), 56.2 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2628)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3Z3 at UniProt or InterPro

Protein Sequence (925 amino acids)

>AMB_RS13225 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MIRSRLFFRLFSAILAAVALFAAAIYVFSVPLIEEKAYEIELNASRTILDNVFVMTGKID
VSLEDRRAMTVESYKAQLRNVVSLAASYLDHVFARADKGEISEAEARRLAFDGLRAFKWG
NNDYIWVTDYNSVIRSHPDPEFQGRDASRVQGPDGRAILPTIIAIAREKGEGFHTYPWQR
LGETRPSEKLSYFIDMPNRGLVIGTGAYLDDIDREVERRKAEAVEDLRQALRNIRIARTG
YVYIFDAAKTMIIHPNANIEGQDFGTRIDPATGRPISEELMAAADSDRPLTYLWDKPSDP
GNYAYEKISWVRHFKGFDWYIASSVYVDELKRSSAVLGNRLVTIALALMVVAGALGYLAV
DWLTRPLNRLAETAEQVQAGNLDAQSGIRRDDEIGLLAEALDAMVRRVKDDISTLDTRVQ
ERTNELEEAETRRRLILDAIPAAIAYLGRDEIIRFVNRGWAELVRQDAAELIGRDLRSAI
GRFAHAAIQAHMERTWAGEEVTFTYSFPHPDGHTVTTRNTLIPQLAANGAVTAMFVLALD
ISAEKATETQLMEAQRMKAVGQLSGGLAHDFNNLLSVILGNLAAARDRYAEIDGLDSYLE
PAVRASRRGADITSRLLAFSRQQPLKPQPVDVSALVREVSVLLSRSLPSSITITIPDEGG
ECWAIADANQLENALINLALNARDAMPDGGRLEMDVRLRRVTDPLTFDEQVEPDDYLEVR
VSDNGLGFAPEAMTRAFEPFFTTKRLGSGLGLSMVYGFVKQSKGYITLDSRLGMGSTVTI
LLPRAAPVAVEGEAEEAAPSPSLWQGQLALIAEDDADVRAVLRGQLVDLGFSVVEAESGD
EAADLFGQIEGLSLVVSDIVMPGMSGIELAGRIRAERPSIRVILISGFSFDTSPEADDLV
ILRKPWDRSDLAAAVARTTEPSDAA