Protein Info for AMB_RS13220 in Magnetospirillum magneticum AMB-1

Annotation: DUF485 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 26 to 52 (27 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details PF04341: DUF485" amino acids 12 to 99 (88 residues), 102.1 bits, see alignment E=6.4e-34

Best Hits

Swiss-Prot: 49% identical to YJCH_SHIFL: Inner membrane protein YjcH (yjcH) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to mag:amb2627)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3Z4 at UniProt or InterPro

Protein Sequence (104 amino acids)

>AMB_RS13220 DUF485 domain-containing protein (Magnetospirillum magneticum AMB-1)
MSDADTYARVRQNPKFHELVKKRTRLAVTLSVIVLGSYYAFMMVVAFAPGILRTPLSQGS
NLTVGVPVGAAIIVVSWLLTGLYSHFANGEFEELNKDVVREVLE