Protein Info for AMB_RS13200 in Magnetospirillum magneticum AMB-1

Annotation: putrescine ABC transporter permease PotH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 305 (188 residues), 57.4 bits, see alignment E=8.4e-20

Best Hits

Swiss-Prot: 60% identical to POTH_ECOLI: Putrescine transport system permease protein PotH (potH) from Escherichia coli (strain K12)

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 100% identity to mag:amb2623)

MetaCyc: 60% identical to putrescine ABC transporter membrane subunit PotH (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3Z8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AMB_RS13200 putrescine ABC transporter permease PotH (Magnetospirillum magneticum AMB-1)
MGGPGVPGLAPGRFPGADQMKTLLEGRGGRFLVGLAPYAWLLLFFLVPFLIVLKISLSEP
QMGIPPYMPLIDWAEGAFKGTLAGYNTLLGDNLYLLAYLGSLKLAGISTLGCLLLGYPAA
YAIARAPQSRRQALLMLVALPFWTSFLIRVYAWIGILKNEGLLNMALQALGLISEPLQIL
ETSTAVVIGMVYSYLPFMILPLYATLEKMDLSLLEAAADLGCRPFKAFLAVTLPLSMPGV
IAGCMLVFIPAVGEFVIPDLLGGPDTLVIGKVLWAEFFDNRDWPTASAVAVAMLVLLVVP
IMVFQHFEAKRQERGE