Protein Info for AMB_RS13175 in Magnetospirillum magneticum AMB-1

Annotation: electron transport complex subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 7 to 200 (194 residues), 199.1 bits, see alignment E=3.1e-63 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 8 to 208 (201 residues), 236.2 bits, see alignment E=1.2e-74

Best Hits

Swiss-Prot: 100% identical to RNFE_MAGSA: Ion-translocating oxidoreductase complex subunit E (rnfE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to mag:amb2618)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W403 at UniProt or InterPro

Protein Sequence (223 amino acids)

>AMB_RS13175 electron transport complex subunit E (Magnetospirillum magneticum AMB-1)
MSASYGRIIKDGLWENNGVLCMLLGMCPTMAMTGTATNGLGMGLATAAVMAASNLMVAMF
RNYVTHEVRIPVYILIVAANVTFVDLGMNAWMHELYKVLGLFIPLIVSNCLPLARLEAFA
AKEPVLPSFLDGLFMGLGFTLALTAIGAVREMIGQGTLFADAALLLGPWAKLLELRVMPA
DWGILVLILPPGGFLIAGLMVVAKRLVDLAGGKEIKMAGAHSV