Protein Info for AMB_RS13165 in Magnetospirillum magneticum AMB-1

Annotation: electron transporter RnfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 7 to 344 (338 residues), 378.1 bits, see alignment E=1.8e-117 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 10 to 345 (336 residues), 370.3 bits, see alignment E=4.9e-115

Best Hits

Swiss-Prot: 51% identical to RNFD_PSEST: Ion-translocating oxidoreductase complex subunit D (rnfD) from Pseudomonas stutzeri

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 100% identity to mag:amb2616)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W405 at UniProt or InterPro

Protein Sequence (358 amino acids)

>AMB_RS13165 electron transporter RnfD (Magnetospirillum magneticum AMB-1)
MSIVIDKSGPFTHGPNSVQRTMFTVLAALAPATLYNLWLFGLPAIFLFLVTMAACALCEA
ACIRISGGNPDRALGDGSVAITGWLLALSLPPWAPWWVAVVASVFAVCLAKHAFGGLGQN
VFNPAMVGRVVVLVSFPLQMTSFVTPKPLFTPGSPGLAESLTITFGRGFTLDGISTASPL
GFIKTELSKGVPVTQSLSSFPSLGDMMIGFHPGSMGETAVPLILLGGLFLMWRKIISWHI
PVSMLATLFLMGTIFSTLDPARHTSGMVQLLSGASFLGAFFIATDYVTSPVSKSGQLAFG
FGVGLLTWIIRTYAGYPEGVAFAVLLMNALTPILDQHFRPRVFGRTRKGEPLPVRGDK