Protein Info for AMB_RS13160 in Magnetospirillum magneticum AMB-1

Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 4 to 436 (433 residues), 571 bits, see alignment E=6.5e-176 PF13375: RnfC_N" amino acids 7 to 105 (99 residues), 110.9 bits, see alignment E=8e-36 PF01512: Complex1_51K" amino acids 131 to 276 (146 residues), 168.7 bits, see alignment E=2.8e-53 PF10531: SLBB" amino acids 289 to 336 (48 residues), 52.3 bits, see alignment 1.2e-17 PF13237: Fer4_10" amino acids 366 to 419 (54 residues), 29.9 bits, see alignment 1.4e-10 PF12838: Fer4_7" amino acids 369 to 421 (53 residues), 28.8 bits, see alignment 4.1e-10

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 100% identity to mag:amb2615)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W406 at UniProt or InterPro

Protein Sequence (498 amino acids)

>AMB_RS13160 electron transport complex subunit RsxC (Magnetospirillum magneticum AMB-1)
MKLFPILGGIHPEYRKELTSEKAIVALPLPKTLYLPLQQHMGAPANTTVNVGDTVKKGQL
LAKAQGAISAALHAPTSGTIAAITEMTAPHPSGLPQLTIVLDSDGKDEWAEPMPVIADPF
AASANEIKARVAEAGIVGMGGATFPSAVKLGLGNQHKLEILLLNGAECEPYLTCDDRVMR
EFAEQVVDGARIMAHALGAPKVIIAVEDNKPQAVDSLKAEAAKTPNVDVVGVPVQYPMGA
ERHLTQAVTGRETPARKLTADVGVVVHNVATARAVHQAVRLGRPLLSRVVTVSGGAVAEP
KNIEVPLGTRVSELLDFCGGVSAAAKRIISGGPMMGQPLPSLDVAVVKGTSGILALTQAE
TNEHAPSPCIRCGSCVTYCPCGLVPVEMASYIRNDKLDLAAKIGVQDCVSCGSCSYICPS
HIPLVHFFNYAKGKIAALDRERRKTEQTKSLVEAHNARLERQAQAKREAAAKAKAAKEAA
EAAAAAQAQTNSAGGANA