Protein Info for AMB_RS13110 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00005: ABC_tran" amino acids 19 to 162 (144 residues), 93.2 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 48% identical to LIVF_SALTI: High-affinity branched-chain amino acid transport ATP-binding protein LivF (livF) from Salmonella typhi

KEGG orthology group: None (inferred from 100% identity to mag:amb2605)

MetaCyc: 46% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivF (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W416 at UniProt or InterPro

Protein Sequence (239 amino acids)

>AMB_RS13110 ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MLEIESLRAGYGSINVLWDLSLSIEEGKLTCILGPNGGGKTTLLRAIMGLVKTESGRVLY
QGRDRTNAPTWDMVADGVAMIPEGRMVFRDMSVADNLLMGAFPKKCRANAPKNLQMVYDM
FPRLYERRDQLAGALSGGEAQMLAMGRGLMEEPKLILVDEPSLGLAPVVVDEVMGILDRL
KQEGLTIVLVEQNTNKALKIADHVYLVRGGKVVLSETADSVDLGRLHDLYFARDTLHEH