Protein Info for AMB_RS13100 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 109 to 125 (17 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 28 to 291 (264 residues), 119.5 bits, see alignment E=7.7e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2603)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W418 at UniProt or InterPro

Protein Sequence (320 amino acids)

>AMB_RS13100 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MTSWIKIAAFLAFSYIAVPLALGSNAYVIGLLVAALTIGGIAVAWALLGNLGGMVSFGHA
AFFGVGAYVSALLTLRGGWPVFPAMLVAGLGAAIASVATMPALRLRGPYFALAILAYAEI
FRILATELKPITGGAAGLLSIPRLPNVLGLDFGTKLGGYFVILTIVVAAMAAYHLIRRSP
YGLALKAMHDSEDATRVVGVNSTLLKAWMLVVSAFITGMVGAFNAHYINFLEPDYAFAGQ
WTTLAIVSAIFGGYRTVSGPLVGAVVVYLVDQLAFKPILPQGHQIVLGVLLGAMILFSPG
GLMPMLMAKLSRKEGHAHAA