Protein Info for AMB_RS13065 in Magnetospirillum magneticum AMB-1

Annotation: 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 13 to 190 (178 residues), 189 bits, E=7.7e-60
• PF00725: 3HCDH
  • amino acids 192 to 289 (98 residues), 83.4 bits, E=1.4e-27
  • amino acids 415 to 497 (83 residues), 57 bits, E=2.4e-19

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 100% identity to mag:amb2596)

MetaCyc: 58% identical to 3-hydroxyacyl-CoA dehydrogenase (Cupriavidus necator H16)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" (EC 1.1.1.157, EC 1.1.1.35)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• adipate degradation (5/5 steps found)
• benzoyl-CoA degradation I (aerobic) (6/7 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• pyruvate fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• phenylacetate degradation I (aerobic) (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• fatty acid β-oxidation I (generic) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• glycerol degradation to butanol (10/16 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• L-glutamate degradation VII (to butanoate) (6/12 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• 2-methylpropene degradation (2/8 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (7/17 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (5/16 steps found)
• toluene degradation VI (anaerobic) (6/18 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (8/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (4/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157, 1.1.1.35

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Sequence Analysis Tools

See Q2W425 at UniProt or InterPro

Protein Sequence (506 amino acids)

>AMB_RS13065 3-hydroxyacyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MSLDANRSDLILGLVGSGTMGRGIAQIAVASGVTVILVDALPGAAAKARDAVSAMLAKLA
EKGKLTAEACASATARLKLGESLADLAPCHVVVEAIVEDIKVKQALMKDLEAIVSKDCLI
ASNTSSLSVTSIAAACQHPQRVGGFHFFNPVPLMKVVEVIDGVMTAPWVVETLTALARRM
GHTPVKAKDTPGFVVNHAGRGYGTEALKLVGEGVTDFFTADRILKGAAGFRMGPFELLDL
TALDVSHPVMESIYDQYYQEPRFRPSPITRSRLVAGLLGRKTGRGFYAYEGDKAVVPPAP
PVPAAWQGPVWVAPGEGSLAVAALVTKLGASLETGEKPGETALILIPVLGEDCTTAVVRL
GLDAARSVAIDPLFGLDSHRTVMTNPVTRAEIRDGAHGLLAGDEVAVSVIADSPGLVAQR
VVATIVNIGCDIAQQRIATPDDIDKAVTLGLGYPAGPLSWGDRIGAAKVVAILDTVLAIT
GDPRYRASLWLKRRAALGVSLLTSES