Protein Info for AMB_RS12995 in Magnetospirillum magneticum AMB-1

Annotation: C4-dicarboxylate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 71 (17 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF04290: DctQ" amino acids 29 to 160 (132 residues), 75.8 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2582)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W439 at UniProt or InterPro

Protein Sequence (187 amino acids)

>AMB_RS12995 C4-dicarboxylate ABC transporter substrate-binding protein (Magnetospirillum magneticum AMB-1)
MKPLLALSSLIDRINEWVGRSVYWLILLMVIVSSGNATIRYIFSNSSNAWLEVQWYLFAA
VFLLCAGYTLLKNEHIRIDVIAGRLPRRTQIWIDILGTLVFLFPMALLILTLSWPMFMKS
FTMMEMSSDAGGLIRWPVKLLLPVGFSLLMLQGVSELIKKIAILTGDLADPGDHGHHHHT
SADGEAA