Protein Info for AMB_RS12960 in Magnetospirillum magneticum AMB-1

Annotation: methylmalonyl-CoA epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 4 to 133 (130 residues), 169 bits, E=3.5e-54
• PF00903: Glyoxalase
  • amino acids 4 to 103 (100 residues), 61.7 bits, E=1.4e-20
• PF13468: Glyoxalase_3
  • amino acids 5 to 100 (96 residues), 30.1 bits, E=7.2e-11
• PF13669: Glyoxalase_4
  • amino acids 6 to 118 (113 residues), 82.3 bits, E=4.7e-27

Best Hits

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 100% identity to mag:amb2575)

MetaCyc: 82% identical to ethylmalonyl-CoA/methylmalonyl-CoA epimerase (Cereibacter sphaeroides)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]; 5.1.99.1 [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• methylaspartate cycle (14/19 steps found)
• superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
• propanoyl CoA degradation I (2/3 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• 2-oxobutanoate degradation I (2/4 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (5/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

See Q2W446 at UniProt or InterPro

Protein Sequence (134 amino acids)

>AMB_RS12960 methylmalonyl-CoA epimerase (Magnetospirillum magneticum AMB-1)
MIGKLNHVAIAVPDLAAATALYRDTLGAKVSAPVPQPAHGVTVVFVELPNTKVELLHPMG
EKSPIAGFLEKNPSGGIHHICYEVEDILAARDKLKATGARVLGDGEPKIGAHDKPVLFLH
PKDFNGTLVELEQA