Protein Info for AMB_RS12940 in Magnetospirillum magneticum AMB-1

Annotation: lipoprotein-releasing system ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 173 (149 residues), 117.4 bits, E=7.9e-38

Best Hits

Swiss-Prot: 100% identical to LOLD_MAGSA: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to mag:amb2571)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See Q2W450 at UniProt or InterPro

Protein Sequence (226 amino acids)

>AMB_RS12940 lipoprotein-releasing system ATP-binding protein LolD (Magnetospirillum magneticum AMB-1)
MNNHGLKLDNIRRAFKQGKDDLEVLKGANLEIRAGEIVALVGPSGAGKSTLLHIAGLLER
PDGGEVFLAGNPAGALGEKERTQLRRLHLGFVYQYHHLLPEFSAIENVVLPQMIAGVPQA
KARERAMELLGRMKLAERAEHRPGQLSGGEQQRVAICRALANAPRVLLADEPTGNLDPHT
ADGVFDELIRLVKGSGVAALIATHNPDLAARMDRVVKMSEGLLVEV