Protein Info for AMB_RS12875 in Magnetospirillum magneticum AMB-1

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF01618: MotA_ExbB" amino acids 108 to 216 (109 residues), 70.2 bits, see alignment E=7e-24

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to mag:amb2558)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W463 at UniProt or InterPro

Protein Sequence (265 amino acids)

>AMB_RS12875 flagellar motor protein MotA (Magnetospirillum magneticum AMB-1)
MSLSTVIGFTLSLLLIVGSIIELTTNFKIFLHLSGLLMVIGGTLAAAHVGFEMRYVRQAL
GNIKAIFFSPKMARGMLTNEVARVIRWGYLLQKSGIQALESDVKSLKSQDAFLAYGVGLV
VSGYTGPEVRHMLDNQVETAFQRHTVSVEILKYMASNAPAFGMMATLVGLVVMLDNMGDD
PSKLGGGMAVGLLGTLYGVLFARLVLMPAAEKAHQRESIIRFRNMLVAEGLVMLAERRSP
RFIQDAMNSYLDPAIHFDIDKAPKK