Protein Info for AMB_RS12825 in Magnetospirillum magneticum AMB-1

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04608: PgpA
  • amino acids 27 to 165 (139 residues), 147.7 bits, E=1.1e-47

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to mag:amb2547)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• cardiolipin biosynthesis I (2/3 steps found)
• cardiolipin biosynthesis II (2/3 steps found)
• cardiolipin biosynthesis III (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (7/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

See Q2W474 at UniProt or InterPro

Protein Sequence (170 amino acids)

>AMB_RS12825 phosphatidylglycerophosphatase A (Magnetospirillum magneticum AMB-1)
MVNQDHGGRPLSYRRAGITVWHPASLVSTWFGAGLLPKGPGTWGSAAALPFAWIIMDAGG
PVSLLAATLACFAVGWWASSVYVRRTGAEDPSEVVIDEVAGQWLVLLAAPLDPLSYLMGF
ALFRAFDIWKPWPVGWADRRIGGGLGIMVDDILAGFYGLGLLVLFNHLRS