Protein Info for AMB_RS12795 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 16 to 230 (215 residues), 45.3 bits, see alignment E=1.3e-15 PF02687: FtsX" amino acids 262 to 371 (110 residues), 61.2 bits, see alignment E=9.5e-21

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mag:amb2541)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W480 at UniProt or InterPro

Protein Sequence (377 amino acids)

>AMB_RS12795 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MNLALRDIRHKLGRFLLTCLGLSLLLGVVLSMIGIYRGLVEDALSLVRAPAADLWVVEAG
SRGPFAEASRMPGDTREMVARVPGVVEAGAVTYQTVETLHQGRKLRLQVVGYEPGRMGGP
AGIESGRAIAIRHGETVVDQRAGIALGERVHLGRDDYLVVGLTRHHVSTGGDPVLFLSLR
DAQDLQFLPKPSTYRRDQARGAPPPALDTINAVVARLAPDVPTDRVAMEIGRWKHLGTAT
QGQQEAILVESVVEKARRQIGLFTAILMVVSAVVIALIIYTMTMDKTREIATLKLIGAPD
RTIVGLILQQALAMGLIGFSMGLGLVNLAADKFPRRVLLQPEDALMLGLVVLAVCVLSSG
LGVRLALRIEPAAALGG